Lineage for d2f8nf_ (2f8n F:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2698056Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2698446Protein Histone H4 [47125] (7 species)
  7. 2698447Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (45 PDB entries)
  8. 2698495Domain d2f8nf_: 2f8n F: [133137]
    Other proteins in same PDB: d2f8na_, d2f8nd_, d2f8ne_, d2f8ng_, d2f8nh_, d2f8nk1
    automated match to d1kx5b_
    protein/DNA complex

Details for d2f8nf_

PDB Entry: 2f8n (more details), 2.9 Å

PDB Description: 2.9 Angstrom X-ray structure of hybrid macroH2A nucleosomes
PDB Compounds: (F:) histone h4

SCOPe Domain Sequences for d2f8nf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f8nf_ a.22.1.1 (F:) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
rkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakr
ktvtamdvvyalkrqgrtlygfgg

SCOPe Domain Coordinates for d2f8nf_:

Click to download the PDB-style file with coordinates for d2f8nf_.
(The format of our PDB-style files is described here.)

Timeline for d2f8nf_: