Lineage for d2f8nd_ (2f8n D:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 909266Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 909267Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 909268Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 909610Protein automated matches [190203] (5 species)
    not a true protein
  7. 909648Species Mouse (Mus musculus) [TaxId:10090] [187087] (1 PDB entry)
  8. 909649Domain d2f8nd_: 2f8n D: [133135]
    Other proteins in same PDB: d2f8nb1, d2f8nf1, d2f8nh1, d2f8nk1
    automated match to d1kx5d_
    protein/DNA complex

Details for d2f8nd_

PDB Entry: 2f8n (more details), 2.9 Å

PDB Description: 2.9 Angstrom X-ray structure of hybrid macroH2A nucleosomes
PDB Compounds: (D:) Histone 3, H2ba

SCOPe Domain Sequences for d2f8nd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f8nd_ a.22.1.1 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiaseasrlahynkrstitsr
evqtavrlllpgelakhavsegtkavtkytssk

SCOPe Domain Coordinates for d2f8nd_:

Click to download the PDB-style file with coordinates for d2f8nd_.
(The format of our PDB-style files is described here.)

Timeline for d2f8nd_: