Class a: All alpha proteins [46456] (284 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (4 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein automated matches [190203] (5 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [187087] (1 PDB entry) |
Domain d2f8nd_: 2f8n D: [133135] Other proteins in same PDB: d2f8nb1, d2f8nf1, d2f8nh1, d2f8nk1 automated match to d1kx5d_ protein/DNA complex |
PDB Entry: 2f8n (more details), 2.9 Å
SCOPe Domain Sequences for d2f8nd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f8nd_ a.22.1.1 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} rkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiaseasrlahynkrstitsr evqtavrlllpgelakhavsegtkavtkytssk
Timeline for d2f8nd_: