![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
![]() | Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families) ![]() |
![]() | Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins) |
![]() | Protein ISP subunit from the cytochrome b6f complex, transmembrane anchor [103428] (2 species) |
![]() | Domain d2d2cq2: 2d2c Q:12-45 [131170] Other proteins in same PDB: d2d2ca1, d2d2cb1, d2d2cd1, d2d2ce1, d2d2cf1, d2d2cg1, d2d2ch1, d2d2cn1, d2d2co1, d2d2cq1, d2d2cr1, d2d2cs1, d2d2ct1, d2d2cu1 automatically matched to d1vf5d2 complexed with bcr, bnt, cla, fes, hec, hem, opc |
PDB Entry: 2d2c (more details), 3.8 Å
SCOPe Domain Sequences for d2d2cq2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d2cq2 f.23.12.1 (Q:12-45) ISP subunit from the cytochrome b6f complex, transmembrane anchor {Mastigocladus laminosus [TaxId: 83541]} dmgrrqfmnllafgtvtgvalgalyplvkyfipp
Timeline for d2d2cq2: