![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily) core: three transmembrane helices, up-and-down bundle |
![]() | Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families) ![]() |
![]() | Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (3 proteins) a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria |
![]() | Protein Subunit IV of the cytochrome b6f complex [103495] (2 species) |
![]() | Species Mastigocladus laminosus [TaxId:83541] [103496] (8 PDB entries) |
![]() | Domain d2d2co1: 2d2c O:18-154 [131168] Other proteins in same PDB: d2d2ca1, d2d2cd1, d2d2cd2, d2d2ce1, d2d2cf1, d2d2cg1, d2d2ch1, d2d2cn1, d2d2cq1, d2d2cq2, d2d2cr1, d2d2cs1, d2d2ct1, d2d2cu1 automatically matched to d1vf5b_ complexed with bcr, bnt, cla, fes, hec, hem, opc |
PDB Entry: 2d2c (more details), 3.8 Å
SCOPe Domain Sequences for d2d2co1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d2co1 f.32.1.1 (O:18-154) Subunit IV of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]} lakgmghnyygepawpndllyvfpvvimgtfacivalsvldpamvgepanpfatpleilp ewylypvfqilrslpnkllgvllmasvplglilvpfienvnkfqnpfrrpvattiflfgt lvtiwlgigaalpldkt
Timeline for d2d2co1: