Lineage for d2d2cq2 (2d2c Q:12-45)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 745533Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
    not a true fold
  4. 745875Superfamily f.23.12: ISP transmembrane anchor [81502] (1 family) (S)
  5. 745876Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins)
  6. 745905Protein ISP subunit from the cytochrome b6f complex, transmembrane anchor [103428] (2 species)
  7. 745908Species Mastigocladus laminosus [TaxId:83541] [103429] (5 PDB entries)
  8. 745915Domain d2d2cq2: 2d2c Q:12-45 [131170]
    Other proteins in same PDB: d2d2ca1, d2d2cb1, d2d2cd1, d2d2cf1, d2d2cg1, d2d2cn1, d2d2co1, d2d2cq1, d2d2cs1, d2d2ct1
    automatically matched to d1vf5d2
    complexed with bcr, bnt, cla, fes, hec, hem, opc

Details for d2d2cq2

PDB Entry: 2d2c (more details), 3.8 Å

PDB Description: Crystal Structure Of Cytochrome B6F Complex with DBMIB From M. Laminosus
PDB Compounds: (Q:) Cytochrome b6-f complex iron-sulfur subunit

SCOP Domain Sequences for d2d2cq2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d2cq2 f.23.12.1 (Q:12-45) ISP subunit from the cytochrome b6f complex, transmembrane anchor {Mastigocladus laminosus [TaxId: 83541]}
dmgrrqfmnllafgtvtgvalgalyplvkyfipp

SCOP Domain Coordinates for d2d2cq2:

Click to download the PDB-style file with coordinates for d2d2cq2.
(The format of our PDB-style files is described here.)

Timeline for d2d2cq2: