SCOPe 2.07: Domain d2d2cq2: 2d2c Q:12-45

Lineage for d2d2cq2 (2d2c Q:12-45)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families)

5. Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins)

6. Protein ISP subunit from the cytochrome b6f complex, transmembrane anchor [103428] (2 species)

7. Species Mastigocladus laminosus [TaxId:83541] [103429] (4 PDB entries)

8. Domain d2d2cq2: 2d2c Q:12-45 [131170]
   Other proteins in same PDB: d2d2ca1, d2d2cb1, d2d2cd1, d2d2ce1, d2d2cf1, d2d2cg1, d2d2ch1, d2d2cn1, d2d2co1, d2d2cq1, d2d2cr1, d2d2cs1, d2d2ct1, d2d2cu1
   automatically matched to d1vf5d2
   complexed with bcr, bnt, cla, fes, hec, hem, opc

Details for d2d2cq2

PDB Entry: 2d2c, 3.8 Å

PDB Description: Crystal Structure Of Cytochrome B6F Complex with DBMIB From M. Laminosus

PDB Compounds: (Q:) Cytochrome b6-f complex iron-sulfur subunit

SCOPe Domain Sequences for d2d2cq2:

Sequence; same for both SEQRES and ATOM records:

>d2d2cq2 f.23.12.1 (Q:12-45) ISP subunit from the cytochrome b6f complex, transmembrane anchor {Mastigocladus laminosus [TaxId: 83541]}
dmgrrqfmnllafgtvtgvalgalyplvkyfipp

Timeline for d2d2cq2:

• d2d2cq2 first appeared in SCOP 1.73
  
• d2d2cq2 appears in SCOPe 2.06
  
• d2d2cq2 appears in the current release, SCOPe 2.08