SCOPe 2.05: Domain d2axvc1: 2axv C:2-66

Lineage for d2axvc1 (2axv C:2-66)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.0: automated matches [191534] (1 protein)
   not a true family

6. Protein automated matches [190907] (8 species)
   not a true protein

7. Species Enterococcus faecalis [TaxId:1351] [255039] (5 PDB entries)

8. Domain d2axvc1: 2axv C:2-66 [127528]
   Other proteins in same PDB: d2axva2, d2axvb2, d2axvc2, d2axvd2
   automated match to d2awia1
   mutant

Details for d2axvc1

PDB Entry: 2axv, 3 Å

PDB Description: structure of prgx y153c mutant

PDB Compounds: (C:) PrgX

SCOPe Domain Sequences for d2axvc1:

Sequence; same for both SEQRES and ATOM records:

>d2axvc1 a.35.1.0 (C:2-66) automated matches {Enterococcus faecalis [TaxId: 1351]}
fkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffei
lnrag

Timeline for d2axvc1:

• d2axvc1 first appeared in SCOP 1.73
  
• d2axvc1 appears in SCOPe 2.04
  
• d2axvc1 appears in SCOPe 2.06
  
• d2axvc1 appears in the current release, SCOPe 2.08