Lineage for d2axva1 (2axv A:2-66)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1732724Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 1732725Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 1733172Family a.35.1.0: automated matches [191534] (1 protein)
    not a true family
  6. 1733173Protein automated matches [190907] (8 species)
    not a true protein
  7. 1733225Species Enterococcus faecalis [TaxId:1351] [255039] (5 PDB entries)
  8. 1733237Domain d2axva1: 2axv A:2-66 [127524]
    Other proteins in same PDB: d2axva2, d2axvb2, d2axvc2, d2axvd2
    automated match to d2awia1
    mutant

Details for d2axva1

PDB Entry: 2axv (more details), 3 Å

PDB Description: structure of prgx y153c mutant
PDB Compounds: (A:) PrgX

SCOPe Domain Sequences for d2axva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2axva1 a.35.1.0 (A:2-66) automated matches {Enterococcus faecalis [TaxId: 1351]}
fkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffei
lnrag

SCOPe Domain Coordinates for d2axva1:

Click to download the PDB-style file with coordinates for d2axva1.
(The format of our PDB-style files is described here.)

Timeline for d2axva1: