SCOPe 2.05: Domain d2axva2: 2axv A:67-303

Lineage for d2axva2 (2axv A:67-303)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (9 families)

5. Family a.118.8.4: PrgX C-terminal domain-like [140848] (2 proteins)

6. Protein automated matches [254479] (1 species)
   not a true protein

7. Species Enterococcus faecalis [TaxId:1351] [255040] (5 PDB entries)

8. Domain d2axva2: 2axv A:67-303 [127525]
   Other proteins in same PDB: d2axva1, d2axvb1, d2axvc1, d2axvd1
   automated match to d2awia2
   mutant

Details for d2axva2

PDB Entry: 2axv, 3 Å

PDB Description: structure of prgx y153c mutant

PDB Compounds: (A:) PrgX

SCOPe Domain Sequences for d2axva2:

Sequence; same for both SEQRES and ATOM records:

>d2axva2 a.118.8.4 (A:67-303) automated matches {Enterococcus faecalis [TaxId: 1351]}
mntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhynie
vptfnktitsdlkhlydkrttffgidceivsnllnvlpyeevssiikpmypivdsfgkdy
dltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkqiyqfl
tdknidsylnavniinifkiigkedihrslveeltkisakekftppkevtmyyenyv

Timeline for d2axva2:

• d2axva2 first appeared in SCOP 1.73
  
• d2axva2 appears in SCOPe 2.04
  
• d2axva2 appears in SCOPe 2.06
  
• d2axva2 appears in the current release, SCOPe 2.08