Class a: All alpha proteins [46456] (286 folds) |
Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) |
Family a.35.1.0: automated matches [191534] (1 protein) not a true family |
Protein automated matches [190907] (8 species) not a true protein |
Species Enterococcus faecalis [TaxId:1351] [255039] (5 PDB entries) |
Domain d2axvb1: 2axv B:2-66 [127526] Other proteins in same PDB: d2axva2, d2axvb2, d2axvc2, d2axvd2 automated match to d2awia1 mutant |
PDB Entry: 2axv (more details), 3 Å
SCOPe Domain Sequences for d2axvb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2axvb1 a.35.1.0 (B:2-66) automated matches {Enterococcus faecalis [TaxId: 1351]} fkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffei lnrag
Timeline for d2axvb1: