SCOPe 2.08: Domain d1zglk1: 1zgl K:93-189

Lineage for d1zglk1 (1zgl K:93-189)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)

7. Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (43 PDB entries)
   Uniprot P04229 30-219
   probably orthologous to the mouse I-E group

8. Domain d1zglk1: 1zgl K:93-189 [125045]
   Other proteins in same PDB: d1zgla1, d1zgla2, d1zglb2, d1zgld1, d1zgld2, d1zgle2, d1zglg1, d1zglg2, d1zglh2, d1zglj1, d1zglj2, d1zglk2, d1zglp1, d1zglp2, d1zglp3, d1zglr1, d1zglr2, d1zglr3, d1zglt1, d1zglt2, d1zglt3, d1zglv1, d1zglv2, d1zglv3
   automatically matched to d1fv1b1

Details for d1zglk1

PDB Entry: 1zgl, 2.8 Å

PDB Description: crystal structure of 3a6 tcr bound to mbp/hla-dr2a

PDB Compounds: (K:) major histocompatibility complex, class II, DR beta 5

SCOPe Domain Sequences for d1zglk1:

Sequence, based on SEQRES records:

>d1zglk1 b.1.1.2 (K:93-189) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvepkvtvypartqtlqhhnllvcsvngfypgsievrwfrnsqeekagvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewr

Sequence, based on observed residues (ATOM records):

>d1zglk1 b.1.1.2 (K:93-189) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvepkvtvypnllvcsvngfypgsievrwfrnsqeekagvvstgliqngdwtfqtlvml
etvprsgevytcqvehpsvtspltvewr

Timeline for d1zglk1:

• d1zglk1 first appeared in SCOP 1.73
  
• d1zglk1 appears in SCOPe 2.07