| Root: SCOPe 2.08 |
| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species) |
| Species Human (Homo sapiens) [TaxId:9606] [88569] (147 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody |
| Domain d1yyll2: 1yyl L:108-212 [124226] Other proteins in same PDB: d1yylg_, d1yylh1, d1yylh2, d1yyll1, d1yylm1, d1yylp_, d1yylq1, d1yylr1, d1yylr2, d1yyls1 automatically matched to d1g9ml2 complexed with nag |
PDB Entry: 1yyl (more details), 2.75 Å
SCOPe Domain Sequences for d1yyll2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yyll2 b.1.1.2 (L:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg
Timeline for d1yyll2: