SCOPe 2.08: Domain d1wc7a1: 1wc7 A:1-107

Lineage for d1wc7a1 (1wc7 A:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d1wc7a1: 1wc7 A:1-107 [120878]
   Other proteins in same PDB: d1wc7a2, d1wc7b1, d1wc7b2, d1wc7h1, d1wc7h2, d1wc7l2
   automated match to d1a5fl1
   complexed with iod, pp3

Details for d1wc7a1

PDB Entry: 1wc7, 2.33 Å

PDB Description: fab fragment of plp-dependent catalytic antibody 15a9 in complex with phosphopyridoxyl-l-alanine

PDB Compounds: (A:) fab fragment of catalytic antibody 15a9, light chain

SCOPe Domain Sequences for d1wc7a1:

Sequence; same for both SEQRES and ATOM records:

>d1wc7a1 b.1.1.0 (A:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dieltqspaimaaspgekvtitcsatsgvnymhwfqqkpgtspklwiystsnlasavpar
fsgsgsgtsysltisrmeaedaatyycqqrstypftfgggtklelk

Timeline for d1wc7a1:

• d1wc7a1 first appeared in SCOP 1.73
  
• d1wc7a1 appears in SCOPe 2.07