PDB entry 1wc7

View 1wc7 on RCSB PDB site
Description: fab fragment of plp-dependent catalytic antibody 15a9 in complex with phosphopyridoxyl-l-alanine
Class: antibody
Keywords: antibody, catalytic antibody, transamination, pyridoxal-phosphate, phosphopyridoxyl-l-alanine
Deposited on 2004-11-09, released 2005-11-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.33 Å
R-factor: 0.2234
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fab fragment of catalytic antibody 15a9, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1WC7 (27-212)
    Domains in SCOPe 2.07: d1wc7a1, d1wc7a2
  • Chain 'B':
    Compound: fab fragment of catalytic antibody 15a9, heavy chain
    Species: Mus musculus [TaxId:10090]
    Domains in SCOPe 2.07: d1wc7b1, d1wc7b2
  • Chain 'H':
    Compound: fab fragment of catalytic antibody 15a9, heavy chain
    Species: Mus musculus [TaxId:10090]
    Domains in SCOPe 2.07: d1wc7h1, d1wc7h2
  • Chain 'L':
    Compound: fab fragment of catalytic antibody 15a9, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1WC7 (27-End)
    Domains in SCOPe 2.07: d1wc7l1, d1wc7l2
  • Heterogens: IOD, PP3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wc7A (A:)
    dieltqspaimaaspgekvtitcsatsgvnymhwfqqkpgtspklwiystsnlasavpar
    fsgsgsgtsysltisrmeaedaatyycqqrstypftfgggtklelkradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wc7B (B:)
    evklqesggglvqpghslrlscatsgftftdyymswvrqppgkalewlglirnkangytk
    eysasvkgrftisrdnsqsilylqmnalraedsatyycvrdkgsygnyeawfaywgqgtt
    vtvssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpa
    vlqsdlytlsssvtvpssprpsetvtcnvahpasstkvdkkivprd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wc7B (B:)
    evklqesggglvqpghslrlscatsgftftdyymswvrqppgkalewlglirnkangytk
    eysasvkgrftisrdnsqsilylqmnalraedsatyycvrdkgsygnyeawfaywgqgtt
    vtvssakttppsvyplapgsqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavl
    qsdlytlsssvtvpssprpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1wc7H (H:)
    evklqesggglvqpghslrlscatsgftftdyymswvrqppgkalewlglirnkangytk
    eysasvkgrftisrdnsqsilylqmnalraedsatyycvrdkgsygnyeawfaywgqgtt
    vtvssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpa
    vlqsdlytlsssvtvpssprpsetvtcnvahpasstkvdkkivprd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wc7H (H:)
    evklqesggglvqpghslrlscatsgftftdyymswvrqppgkalewlglirnkangytk
    eysasvkgrftisrdnsqsilylqmnalraedsatyycvrdkgsygnyeawfaywgqgtt
    vtvssakttppsvyplapgsqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavl
    qsdlytlsssvtvpssprpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1wc7L (L:)
    dieltqspaimaaspgekvtitcsatsgvnymhwfqqkpgtspklwiystsnlasavpar
    fsgsgsgtsysltisrmeaedaatyycqqrstypftfgggtklelkradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wc7L (L:)
    dieltqspaimaaspgekvtitcsatsgvnymhwfqqkpgtspklwiystsnlasavpar
    fsgsgsgtsysltisrmeaedaatyycqqrstypftfgggtklelkradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrne