Class b: All beta proteins [48724] (180 folds) |
Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) two constituent families are related by circular permutation |
Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins) topologically similar to the C-terminal domain of PapD |
Protein Synaptotagmin XIII [117084] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [117085] (1 PDB entry) Uniprot Q7L8C5 155-280 |
Domain d1wfma1: 1wfm A:8-132 [114587] Other proteins in same PDB: d1wfma2, d1wfma3 Structural genomics target; 1st C2 domain (of 2) |
PDB Entry: 1wfm (more details)
SCOPe Domain Sequences for d1wfma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wfma1 b.7.1.2 (A:8-132) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} swnqapklhycldydcqkaelfvtrleavtsnhdggcdcyvqgsvanrtgsveaqtalkk rqlhttweeglvlplaeeelptatltltlrtcdrfsrhsvagelrlgldgtsvplgaaqw gelkt
Timeline for d1wfma1: