PDB entry 1wfm

View 1wfm on RCSB PDB site
Description: The first C2 domain of human synaptotagmin XIII
Class: endocytosis/exocytosis
Keywords: C2 domain, exocytosis, neurotransmitter release, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, ENDOCYTOSIS/EXOCYTOSIS COMPLEX
Deposited on 2004-05-26, released 2004-11-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: synaptotagmin XIII
  Species: Homo sapiens [TaxId:9606]
  Gene: Kazusa cDNA fh02770
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7L8C5 (7-131)
    • cloning artifact (0-6)
    • cloning artifact (132-137)
  Domains in SCOPe 2.08: d1wfma1, d1wfma2, d1wfma3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wfmA (A:)
  gssgssgswnqapklhycldydcqkaelfvtrleavtsnhdggcdcyvqgsvanrtgsve
  aqtalkkrqlhttweeglvlplaeeelptatltltlrtcdrfsrhsvagelrlgldgtsv
  plgaaqwgelktsgpssg