| Root: SCOPe 2.08 |
| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.4: I set domains [49159] (39 proteins) |
| Protein CD3 gamma chain ectodomain fragment [69160] (2 species) possibly an intermediate structure between the I set and FnIII domains |
| Species Human (Homo sapiens) [TaxId:9606] [110050] (1 PDB entry) Uniprot P09693 # CD3G_HUMAN T-cell surface glycoprotein CD3 gamma chain precursor |
| Domain d1sy6a1: 1sy6 A:1-81 [106111] Other proteins in same PDB: d1sy6a2, d1sy6h1, d1sy6h2, d1sy6h3, d1sy6l1, d1sy6l2 MQ P09693 P07766 # artificial chimera |
PDB Entry: 1sy6 (more details), 2.1 Å
SCOPe Domain Sequences for d1sy6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sy6a1 b.1.1.4 (A:1-81) CD3 gamma chain ectodomain fragment {Human (Homo sapiens) [TaxId: 9606]}
qsikgnhlvkvydyqedgsvlltcdaeaknitwfkdgkmigfltedkkkwnlgsnakdpr
gmyqckgsqnkskplqvyyrm
Timeline for d1sy6a1: