PDB entry 1sy6

View 1sy6 on RCSB PDB site
Description: Crystal Structure of CD3gammaepsilon Heterodimer in Complex with OKT3 Fab Fragment
Class: signaling protein/antibiotic
Keywords: CD3 gamma, CD3 epsilon, OKT3 Fab, signaling protein-antibiotic COMPLEX
Deposited on 2004-03-31, released 2004-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-02, with a file datestamp of 2017-07-28.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: -1.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: T-cell surface glycoprotein CD3 gamma/epsilon chain
    Species: Homo sapiens [TaxId:9606]
    Gene: CD3G, T3G, CD3E, T3E
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sy6a1, d1sy6a2
  • Chain 'H':
    Compound: OKT3 Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1SY6 (0-218)
    Domains in SCOPe 2.07: d1sy6h1, d1sy6h2, d1sy6h3
  • Chain 'L':
    Compound: OKT3 Fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1SY6 (0-212)
    Domains in SCOPe 2.07: d1sy6l1, d1sy6l2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sy6A (A:)
    mqsikgnhlvkvydyqedgsvlltcdaeaknitwfkdgkmigfltedkkkwnlgsnakdp
    rgmyqckgsqnkskplqvyyrmgsaddakkdaakkddakkddakkdgsdgneemggitqt
    pykvsisgttviltcpqypgseilwqhndkniggdeddknigsdedhlslkefseleqsg
    yyvcyprgskpedanfylylrarv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sy6A (A:)
    mqsikgnhlvkvydyqedgsvlltcdaeaknitwfkdgkmigfltedkkkwnlgsnakdp
    rgmyqckgsqnkskplqvyyrmqtpykvsisgttviltcpqypgseilwqhndkniggde
    ddknigsdedhlslkefseleqsgyyvcyprgskpedanfylylrarv
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sy6H (H:)
    qvqlqqsgaelarpgasvkmsckasgytftrytmhwvkqrpgqglewigyinpsrgytny
    nqkfkdkatlttdkssstaymqlssltsedsavyycaryyddhycldywgqgttltvssa
    kttapsvyplapvcggttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdl
    ytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sy6L (L:)
    qivltqspaimsaspgekvtmtcsasssvsymnwyqqksgtspkrwiydtsklasgvpah
    frgsgsgtsysltisgmeaedaatyycqqwssnpftfgsgtkleinradtaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrnec