| Root: SCOPe 2.08 |
| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein Immunomodulatory protein m144, alpha-3 domain [110048] (1 species) |
| Species Murine cytomegalovirus [TaxId:10366] [110049] (2 PDB entries) Uniprot Q69G19 27-263 # 95% sequence identity |
| Domain d1pqza1: 1pqz A:144-242 [104297] Other proteins in same PDB: d1pqza2, d1pqzb_ |
PDB Entry: 1pqz (more details), 2.1 Å
SCOPe Domain Sequences for d1pqza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pqza1 b.1.1.2 (A:144-242) Immunomodulatory protein m144, alpha-3 domain {Murine cytomegalovirus [TaxId: 10366]}
spqleverrssgreggmrlrcfardyypadleirwwkddggggalpqtskqhhdplpsgq
glyqkhidvyvdgglehvyscrvkgiatglelqivrwkg
Timeline for d1pqza1: