Lineage for d1vf5c3 (1vf5 C:250-286)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026281Superfamily f.23.23: Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor [103431] (1 family) (S)
  5. 3026282Family f.23.23.1: Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor [103432] (1 protein)
  6. 3026283Protein Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor [103433] (2 species)
  7. 3026286Species Mastigocladus laminosus [TaxId:83541] [103434] (2 PDB entries)
  8. 3026288Domain d1vf5c3: 1vf5 C:250-286 [100582]
    Other proteins in same PDB: d1vf5a_, d1vf5b_, d1vf5c1, d1vf5c2, d1vf5d1, d1vf5d2, d1vf5e_, d1vf5f_, d1vf5g_, d1vf5h_, d1vf5n_, d1vf5o_, d1vf5p1, d1vf5p2, d1vf5q1, d1vf5q2, d1vf5r_, d1vf5s_, d1vf5t_, d1vf5u_
    complexed with bcr, cla, fes, hem, opc, pl9, tds

Details for d1vf5c3

PDB Entry: 1vf5 (more details), 3 Å

PDB Description: Crystal Structure of Cytochrome b6f Complex from M.laminosus
PDB Compounds: (C:) cytochrome f

SCOPe Domain Sequences for d1vf5c3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vf5c3 f.23.23.1 (C:250-286) Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor {Mastigocladus laminosus [TaxId: 83541]}
qdpnrvkwmiaficlvmlaqlmlilkkkqvekvqaae

SCOPe Domain Coordinates for d1vf5c3:

Click to download the PDB-style file with coordinates for d1vf5c3.
(The format of our PDB-style files is described here.)

Timeline for d1vf5c3: