SCOPe 2.08: Domain d1vf5c2: 1vf5 C:170-231

Lineage for d1vf5c2 (1vf5 C:170-231)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families)

5. Family b.84.2.2: Cytochrome f, small domain [51256] (1 protein)

6. Protein Cytochrome f, small domain [51257] (5 species)

7. Species Mastigocladus laminosus [TaxId:83541] [102005] (2 PDB entries)

8. Domain d1vf5c2: 1vf5 C:170-231 [100581]
   Other proteins in same PDB: d1vf5a_, d1vf5b_, d1vf5c1, d1vf5c3, d1vf5d1, d1vf5d2, d1vf5e_, d1vf5f_, d1vf5g_, d1vf5h_, d1vf5n_, d1vf5o_, d1vf5p1, d1vf5p3, d1vf5q1, d1vf5q2, d1vf5r_, d1vf5s_, d1vf5t_, d1vf5u_
   complexed with bcr, cla, fes, hem, opc, pl9, tds

Details for d1vf5c2

PDB Entry: 1vf5, 3 Å

PDB Description: Crystal Structure of Cytochrome b6f Complex from M.laminosus

PDB Compounds: (C:) cytochrome f

SCOPe Domain Sequences for d1vf5c2:

Sequence; same for both SEQRES and ATOM records:

>d1vf5c2 b.84.2.2 (C:170-231) Cytochrome f, small domain {Mastigocladus laminosus [TaxId: 83541]}
nvftasatgtitkiakeedeygnvkyqvsiqtdsgktvvdtipagpelivsegqavkage
al

Timeline for d1vf5c2:

• d1vf5c2 first appeared in SCOP 1.67
  
• d1vf5c2 appears in SCOPe 2.07