Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily) core: three transmembrane helices, up-and-down bundle |
Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families) |
Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (3 proteins) a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria |
Protein Subunit IV of the cytochrome b6f complex [103495] (2 species) |
Species Mastigocladus laminosus [TaxId:83541] [103496] (8 PDB entries) |
Domain d1vf5b_: 1vf5 B: [100579] Other proteins in same PDB: d1vf5a_, d1vf5c1, d1vf5c2, d1vf5c3, d1vf5d1, d1vf5d2, d1vf5e_, d1vf5f_, d1vf5g_, d1vf5h_, d1vf5n_, d1vf5p1, d1vf5p2, d1vf5p3, d1vf5q1, d1vf5q2, d1vf5r_, d1vf5s_, d1vf5t_, d1vf5u_ complexed with bcr, cla, fes, hem, opc, pl9, tds |
PDB Entry: 1vf5 (more details), 3 Å
SCOPe Domain Sequences for d1vf5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vf5b_ f.32.1.1 (B:) Subunit IV of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]} lakgmghnyygepawpndllyvfpvvimgtfacivalsvldpamvgepanpfatpleilp ewylypvfqilrslpnkllgvllmasvplglilvpfienvnkfqnpfrrpvattiflfgt lvtiwlgigaalpldktl
Timeline for d1vf5b_: