SCOPe 2.08: Domain d1vf5a_: 1vf5 A:

Lineage for d1vf5a_ (1vf5 A:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
   core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices

4. Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families)
   Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically

5. Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins)
   a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria

6. Protein Cytochrome b6 subunit of the cytochrome b6f complex [103498] (2 species)

7. Species Mastigocladus laminosus [TaxId:83541] [103499] (4 PDB entries)

8. Domain d1vf5a_: 1vf5 A: [100578]
   Other proteins in same PDB: d1vf5b_, d1vf5c1, d1vf5c2, d1vf5c3, d1vf5d1, d1vf5d2, d1vf5e_, d1vf5f_, d1vf5g_, d1vf5h_, d1vf5o_, d1vf5p1, d1vf5p2, d1vf5p3, d1vf5q1, d1vf5q2, d1vf5r_, d1vf5s_, d1vf5t_, d1vf5u_
   complexed with bcr, cla, fes, hem, opc, pl9, tds

Details for d1vf5a_

PDB Entry: 1vf5, 3 Å

PDB Description: Crystal Structure of Cytochrome b6f Complex from M.laminosus

PDB Compounds: (A:) Cytochrome b6

SCOPe Domain Sequences for d1vf5a_:

Sequence; same for both SEQRES and ATOM records:

>d1vf5a_ f.21.1.2 (A:) Cytochrome b6 subunit of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]}
eiqaladdvtskyvpphvnifyclggitltcfliqfatgfamtfyykptvteayasvqyi
mnevsfgwlirsihrwsasmmvlmmilhvfrvyltggfkkpreltwisgvilavitvsfg
vtgyslpwdqvgywavkivsgvpeaipvvgvlisdllrggssvgqatltryysahtfvlp
wliavfmllhflmirkqgisgp

Timeline for d1vf5a_:

• d1vf5a_ first appeared in SCOP 1.67
  
• d1vf5a_ appears in SCOPe 2.07