Lineage for d4lpta_ (4lpt A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1767525Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 1768056Family b.1.2.0: automated matches [191562] (1 protein)
    not a true family
  6. 1768057Protein automated matches [190976] (4 species)
    not a true protein
  7. 1768058Species Artificial gene [TaxId:32630] [233328] (6 PDB entries)
  8. 1768066Domain d4lpta_: 4lpt A: [236444]
    automated match to d2cuma1

Details for d4lpta_

PDB Entry: 4lpt (more details), 2.54 Å

PDB Description: Crystal structure of monomeric TENCON variant P54CR4-31
PDB Compounds: (A:) TENCON variant P54CR4-31

SCOPe Domain Sequences for d4lpta_:

Sequence, based on SEQRES records: (download)

>d4lpta_ b.1.2.0 (A:) automated matches {Artificial gene [TaxId: 32630]}
papknlvvsevtedslrlswtapdaafdsfliqyqesekvgeainltvpgsersydltgl
kpgteytvsiygvlgsyvfehdvmlplsaefttggh

Sequence, based on observed residues (ATOM records): (download)

>d4lpta_ b.1.2.0 (A:) automated matches {Artificial gene [TaxId: 32630]}
papknlvvsevtedslrlswtapdaafdsfliqyqeseeainltvpgsersydltglkpg
teytvsiygvlgsyvfehdvmlplsaefttggh

SCOPe Domain Coordinates for d4lpta_:

Click to download the PDB-style file with coordinates for d4lpta_.
(The format of our PDB-style files is described here.)

Timeline for d4lpta_: