SCOPe 2.05: Domain d4lpte_: 4lpt E:

Lineage for d4lpte_ (4lpt E:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.0: automated matches [191562] (1 protein)
   not a true family

6. Protein automated matches [190976] (4 species)
   not a true protein

7. Species Artificial gene [TaxId:32630] [233328] (6 PDB entries)

8. Domain d4lpte_: 4lpt E: [240498]
   automated match to d4lpta_

Details for d4lpte_

PDB Entry: 4lpt, 2.54 Å

PDB Description: Crystal structure of monomeric TENCON variant P54CR4-31

PDB Compounds: (E:) TENCON variant P54CR4-31

SCOPe Domain Sequences for d4lpte_:

Sequence; same for both SEQRES and ATOM records:

>d4lpte_ b.1.2.0 (E:) automated matches {Artificial gene [TaxId: 32630]}
mlpapknlvvsevtedslrlswtapdaafdsfliqyqesekvgeainltvpgsersydlt
glkpgteytvsiygvlgsyvfehdvmlplsaefttggh

Timeline for d4lpte_:

• d4lpte_ first appeared in SCOPe 2.04
  
• d4lpte_ is called d4lpte1 in SCOPe 2.06
  
• d4lpte_ appears in the current release, SCOPe 2.08, called d4lpte1