Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.0: automated matches [191562] (1 protein) not a true family |
Protein automated matches [190976] (4 species) not a true protein |
Species Artificial gene [TaxId:32630] [233328] (6 PDB entries) |
Domain d4lpte_: 4lpt E: [240498] automated match to d4lpta_ |
PDB Entry: 4lpt (more details), 2.54 Å
SCOPe Domain Sequences for d4lpte_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lpte_ b.1.2.0 (E:) automated matches {Artificial gene [TaxId: 32630]} mlpapknlvvsevtedslrlswtapdaafdsfliqyqesekvgeainltvpgsersydlt glkpgteytvsiygvlgsyvfehdvmlplsaefttggh
Timeline for d4lpte_: