SCOPe 2.06: Domain d4lpta1: 4lpt A:3-95

Lineage for d4lpta1 (4lpt A:3-95)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.0: automated matches [191562] (1 protein)
   not a true family

6. Protein automated matches [190976] (4 species)
   not a true protein

7. Species Artificial gene [TaxId:32630] [233328] (6 PDB entries)

8. Domain d4lpta1: 4lpt A:3-95 [236444]
   Other proteins in same PDB: d4lpta2, d4lptb2, d4lptc2, d4lptd2, d4lpte2
   automated match to d2cuma1

Details for d4lpta1

PDB Entry: 4lpt, 2.54 Å

PDB Description: Crystal structure of monomeric TENCON variant P54CR4-31

PDB Compounds: (A:) TENCON variant P54CR4-31

SCOPe Domain Sequences for d4lpta1:

Sequence, based on SEQRES records:

>d4lpta1 b.1.2.0 (A:3-95) automated matches {Artificial gene [TaxId: 32630]}
papknlvvsevtedslrlswtapdaafdsfliqyqesekvgeainltvpgsersydltgl
kpgteytvsiygvlgsyvfehdvmlplsaeftt

Sequence, based on observed residues (ATOM records):

>d4lpta1 b.1.2.0 (A:3-95) automated matches {Artificial gene [TaxId: 32630]}
papknlvvsevtedslrlswtapdaafdsfliqyqeseeainltvpgsersydltglkpg
teytvsiygvlgsyvfehdvmlplsaeftt

Timeline for d4lpta1:

• d4lpta1 first appeared in SCOPe 2.03, called d4lpta_
  
• d4lpta1 was called d4lpta_ in SCOPe 2.05
  
• d4lpta1 appears in SCOPe 2.07
  
• d4lpta1 appears in the current release, SCOPe 2.08