Class b: All beta proteins [48724] (180 folds) |
Fold b.75: Bacteriochlorophyll A protein [51080] (1 superfamily) single sheet; 16 strands; meander |
Superfamily b.75.1: Bacteriochlorophyll A protein [51081] (1 family) automatically mapped to Pfam PF02327 |
Family b.75.1.1: Bacteriochlorophyll A protein [51082] (2 proteins) |
Protein automated matches [190386] (4 species) not a true protein |
Species Chlorobaculum tepidum [TaxId:1097] [187240] (2 PDB entries) |
Domain d3bsda_: 3bsd A: [155524] automated match to d1ksaa_ complexed with bcl, mg |
PDB Entry: 3bsd (more details), 2.3 Å
SCOPe Domain Sequences for d3bsda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bsda_ b.75.1.1 (A:) automated matches {Chlorobaculum tepidum [TaxId: 1097]} dvttahsdyeivleggssswgkvkarakvnappaspllpadcdvklnvkpldpakgfvri savfesivdstknkltieadianetkerrisvgegmvsvgdfshtfsfegsvvnlfyyrs davrrnvpnpiymqgrqfhdilmkvpldnndlidtwegtvkaigstgafndwirdfwfig paftalneggqrisrievnglntesgpkgpvgvsrwrfshggsgmvdsisrwaelfpsdk lnrpaqveagfrsdsqgievkvdgefpgvsvdaggglrrilnhpliplvhhgmvgkfnnf nvdaqlkvvlpkgykiryaapqyrsqnleeyrwsggayarwvehvckggvgqfeilyaq
Timeline for d3bsda_: