SCOP 1.75: Domain d3bsda1: 3bsd A:10-366

Lineage for d3bsda1 (3bsd A:10-366)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.75: Bacteriochlorophyll A protein [51080] (1 superfamily)
   single sheet; 16 strands; meander

4. Superfamily b.75.1: Bacteriochlorophyll A protein [51081] (1 family)

5. Family b.75.1.1: Bacteriochlorophyll A protein [51082] (1 protein)

6. Protein Bacteriochlorophyll A protein [51083] (2 species)

7. Species Green sulfur bacterium (Chlorobium tepidum) [TaxId:1097] [51085] (3 PDB entries)

8. Domain d3bsda1: 3bsd A:10-366 [155524]
   automatically matched to d1ksaa_
   complexed with bcl, mg

Details for d3bsda1

PDB Entry: 3bsd, 2.3 Å

PDB Description: light harvesting protein from rc of chlorobium tepidum

PDB Compounds: (A:) Bacteriochlorophyll a protein

SCOP Domain Sequences for d3bsda1:

Sequence; same for both SEQRES and ATOM records:

>d3bsda1 b.75.1.1 (A:10-366) Bacteriochlorophyll A protein {Green sulfur bacterium (Chlorobium tepidum) [TaxId: 1097]}
ttahsdyeivleggssswgkvkarakvnappaspllpadcdvklnvkpldpakgfvrisa
vfesivdstknkltieadianetkerrisvgegmvsvgdfshtfsfegsvvnlfyyrsda
vrrnvpnpiymqgrqfhdilmkvpldnndlidtwegtvkaigstgafndwirdfwfigpa
ftalneggqrisrievnglntesgpkgpvgvsrwrfshggsgmvdsisrwaelfpsdkln
rpaqveagfrsdsqgievkvdgefpgvsvdaggglrrilnhpliplvhhgmvgkfnnfnv
daqlkvvlpkgykiryaapqyrsqnleeyrwsggayarwvehvckggvgqfeilyaq

Timeline for d3bsda1:

• d3bsda1 is new in SCOP 1.75
  
• d3bsda1 is called d3bsda_ in SCOPe 2.01
  
• d3bsda1 appears in the current release, SCOPe 2.08, called d3bsda_