Lineage for d1ksaa_ (1ksa A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.75: Bacteriochlorophyll A protein [51080] (1 superfamily)
single sheet; 16 strands; meanderSuperfamily b.75.1: Bacteriochlorophyll A protein [51081] (1 family) 
automatically mapped to Pfam PF02327Family b.75.1.1: Bacteriochlorophyll A protein [51082] (2 proteins) 
Protein automated matches [190386] (4 species)
not a true protein
Species Chlorobaculum tepidum [TaxId:1097] [187240] (2 PDB entries) 
Domain d1ksaa_: 1ksa A: [302636]
automated match to d3bsda_
complexed with bcl
Details for d1ksaa_
PDB Entry: 1ksa (more details), 2.2 Å
PDB Description: crystal structure of the bacteriochlorophyll a protein from chlorobium tepidum
PDB Compounds: (A:) Bacteriochlorophyll a proteinSCOPe Domain Sequences for d1ksaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ksaa_ b.75.1.1 (A:) automated matches {Chlorobaculum tepidum [TaxId: 1097]}
ttahsdyeivleggssswgkvkarakvnappaspllpadcdvklnvkpldpakgfvrisa
vfesivdstknkltieadianetkerrisvgegmvsvgdfshtfsfegsvvnlfyyrsda
vrrnvpnpiymqgrqfhdilmkvpldnndlidtwegtvkaigstgafndwirdfwfigpa
ftalneggqrisrievnglntesgpkgpvgvsrwrfshggsgmvdsisrwaelfpsdkln
rpaqveagfrsdsqgievkvdgefpgvsvdaggglrrilnhpliplvhhgmvgkfnnfnv
daqlkvvlpkgykiryaapqyrsqnleeyrwsggayarwvehvckggvgqfeilyaq
SCOPe Domain Coordinates for d1ksaa_:
Click to download the PDB-style file with coordinates for d1ksaa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ksaa_:
- d1ksaa_ first appeared in SCOPe 2.06
- d1ksaa_ appears in SCOPe 2.07
View in 3D
