Class b: All beta proteins [48724] (180 folds) |
Fold b.75: Bacteriochlorophyll A protein [51080] (1 superfamily) single sheet; 16 strands; meander |
Superfamily b.75.1: Bacteriochlorophyll A protein [51081] (1 family) automatically mapped to Pfam PF02327 |
Family b.75.1.1: Bacteriochlorophyll A protein [51082] (2 proteins) |
Protein automated matches [190386] (4 species) not a true protein |
Species Chlorobaculum tepidum [TaxId:1097] [187240] (2 PDB entries) |
Domain d1ksaa_: 1ksa A: [302636] automated match to d3bsda_ complexed with bcl |
PDB Entry: 1ksa (more details), 2.2 Å
SCOPe Domain Sequences for d1ksaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ksaa_ b.75.1.1 (A:) automated matches {Chlorobaculum tepidum [TaxId: 1097]} ttahsdyeivleggssswgkvkarakvnappaspllpadcdvklnvkpldpakgfvrisa vfesivdstknkltieadianetkerrisvgegmvsvgdfshtfsfegsvvnlfyyrsda vrrnvpnpiymqgrqfhdilmkvpldnndlidtwegtvkaigstgafndwirdfwfigpa ftalneggqrisrievnglntesgpkgpvgvsrwrfshggsgmvdsisrwaelfpsdkln rpaqveagfrsdsqgievkvdgefpgvsvdaggglrrilnhpliplvhhgmvgkfnnfnv daqlkvvlpkgykiryaapqyrsqnleeyrwsggayarwvehvckggvgqfeilyaq
Timeline for d1ksaa_: