SCOPe 2.06: Structural Classification of Proteins

PDB entry 3a5c

View 3a5c on RCSB PDB site
Description: Inter-subunit interaction and quaternary rearrangement defined by the central stalk of prokaryotic V1-ATPase
Class: hydrolase
Keywords: V-ATPase, asymmetric, crystal structure, rotation, vacuolar type, HYDROLASE, ATP synthesis, ATP-binding, Hydrogen ion transport, Ion transport, Nucleotide-binding, Transport
Deposited on 2009-08-06, released 2009-10-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-11-17, with a file datestamp of 2009-11-13.
Experiment type: XRAY
Resolution: 4.51 Å
R-factor: 0.429
AEROSPACI score: -0.12 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: V-type ATP synthase alpha chain
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- Uniprot Q56403 (0-End)
Domains in SCOPe 2.06: d3a5ca1, d3a5ca2, d3a5ca3, d3a5ca4
Chain 'B':
Compound: V-type ATP synthase alpha chain
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- Uniprot Q56403 (0-End)
Domains in SCOPe 2.06: d3a5cb1, d3a5cb2, d3a5cb3, d3a5cb4
Chain 'C':
Compound: V-type ATP synthase alpha chain
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- Uniprot Q56403 (0-End)
Domains in SCOPe 2.06: d3a5cc1, d3a5cc2, d3a5cc3, d3a5cc4
Chain 'D':
Compound: V-type ATP synthase beta chain
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- Uniprot Q56404
Domains in SCOPe 2.06: d3a5cd1, d3a5cd2, d3a5cd3
Chain 'E':
Compound: V-type ATP synthase beta chain
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- Uniprot Q56404
Domains in SCOPe 2.06: d3a5ce1, d3a5ce2, d3a5ce3
Chain 'F':
Compound: V-type ATP synthase beta chain
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- Uniprot Q56404
Domains in SCOPe 2.06: d3a5cf1, d3a5cf2, d3a5cf3
Chain 'G':
Compound: V-type ATP synthase subunit D
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- Uniprot O87880 (0-End)
Domains in SCOPe 2.06: d3a5cg_
Chain 'H':
Compound: V-type ATP synthase subunit F
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- Uniprot P74903 (0-103)
Domains in SCOPe 2.06: d3a5ch_
Chain 'I':
Compound: V-type ATP synthase alpha chain
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- Uniprot Q56403 (0-End)
Domains in SCOPe 2.06: d3a5ci1, d3a5ci2, d3a5ci3, d3a5ci4
Chain 'J':
Compound: V-type ATP synthase alpha chain
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- Uniprot Q56403 (0-End)
Domains in SCOPe 2.06: d3a5cj1, d3a5cj2, d3a5cj3, d3a5cj4
Chain 'K':
Compound: V-type ATP synthase alpha chain
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- Uniprot Q56403 (0-End)
Domains in SCOPe 2.06: d3a5ck1, d3a5ck2, d3a5ck3, d3a5ck4
Chain 'L':
Compound: V-type ATP synthase beta chain
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- Uniprot Q56404
Domains in SCOPe 2.06: d3a5cl1, d3a5cl2, d3a5cl3
Chain 'M':
Compound: V-type ATP synthase beta chain
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- Uniprot Q56404
Domains in SCOPe 2.06: d3a5cm1, d3a5cm2, d3a5cm3
Chain 'N':
Compound: V-type ATP synthase beta chain
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- Uniprot Q56404
Domains in SCOPe 2.06: d3a5cn1, d3a5cn2, d3a5cn3
Chain 'O':
Compound: V-type ATP synthase subunit D
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- Uniprot O87880 (0-End)
Domains in SCOPe 2.06: d3a5co_
Chain 'P':
Compound: V-type ATP synthase subunit F
Species: Thermus thermophilus [TaxId:300852]
Database cross-references and differences (RAF-indexed):
- Uniprot P74903 (0-103)
Domains in SCOPe 2.06: d3a5cp_
Heterogens: ADP

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>3a5cA (A:)
miqgviqkiagpaviakgmlgarmydickvgeeglvgeiirldgdtafvqvyedtsglkv
gepvvstglplavelgpgmlngiydgiqrplerirektgiyitrgvvvhaldrekkwawt
pmvkpgdevrggmvlgtvpefgfthkilvppdvrgrvkevkpageytveepvvvledgte
lkmyhtwpvrrarpvqrkldpntpfltgmrildvlfpvamggtaaipgpfgsgktvtqqs
lakwsnadvvvyvgcgergnemtdvlvefpeltdpktggplmhrtvliantsnmpvaare
asiyvgvtiaeyfrdqgfsvalmadstsrwaealreissrleempaeegyppylaarlaa
fyeragkvitlggeegavtivgavsppggdmsepvtqstlrivgafwrldaslafrrhfp
ainwngsyslftsaldpwyrenvaedypelrdaisellqreaglqeivqlvgpdalqdae
rlvievgriiredflqqnayhevdaycsmkkaygimkmilafykeaeaaikrgvsideil
qlpvlerigraryvseeefpayfeeamkeiqgafkala