SCOPe 2.06: Domain d3a5cf1: 3a5c F:7-78

Lineage for d3a5cf1 (3a5c F:7-78)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families)
   automatically mapped to Pfam PF02874

5. Family b.49.1.2: N-terminal domain of A and B subunits of V1 ATP synthase [310615] (2 proteins)

6. Protein V1 ATP synthase B subunit, domain 1 [310702] (2 species)

7. Species Thermus thermophilus HB8 [TaxId:300852] [310926] (2 PDB entries)

8. Domain d3a5cf1: 3a5c F:7-78 [304886]
   Other proteins in same PDB: d3a5ca1, d3a5ca2, d3a5ca3, d3a5ca4, d3a5cb1, d3a5cb2, d3a5cb3, d3a5cb4, d3a5cc1, d3a5cc2, d3a5cc3, d3a5cc4, d3a5cd2, d3a5cd3, d3a5ce2, d3a5ce3, d3a5cf2, d3a5cf3, d3a5cg_, d3a5ch_, d3a5ci1, d3a5ci2, d3a5ci3, d3a5ci4, d3a5cj1, d3a5cj2, d3a5cj3, d3a5cj4, d3a5ck1, d3a5ck2, d3a5ck3, d3a5ck4, d3a5cl2, d3a5cl3, d3a5cm2, d3a5cm3, d3a5cn2, d3a5cn3, d3a5co_, d3a5cp_
   complexed with adp

Details for d3a5cf1

PDB Entry: 3a5c, 4.51 Å

PDB Description: Inter-subunit interaction and quaternary rearrangement defined by the central stalk of prokaryotic V1-ATPase

PDB Compounds: (F:) V-type ATP synthase beta chain

SCOPe Domain Sequences for d3a5cf1:

Sequence; same for both SEQRES and ATOM records:

>d3a5cf1 b.49.1.2 (F:7-78) V1 ATP synthase B subunit, domain 1 {Thermus thermophilus HB8 [TaxId: 300852]}
eytgityisgpllfvenakdlaygaivdikdgtgrvrggqvievseeyaviqvfeettgl
dlattsvslved

Timeline for d3a5cf1:

• d3a5cf1 is new in SCOPe 2.06-stable
  
• d3a5cf1 appears in SCOPe 2.07
  
• d3a5cf1 appears in the current release, SCOPe 2.08