![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (21 proteins) core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest |
![]() | Protein V1 ATP synthase B subunit, central domain [310705] (2 species) |
![]() | Species Thermus thermophilus HB8 [TaxId:300852] [310933] (2 PDB entries) |
![]() | Domain d3a5cm2: 3a5c M:79-361 [304907] Other proteins in same PDB: d3a5ca1, d3a5ca2, d3a5ca3, d3a5ca4, d3a5cb1, d3a5cb2, d3a5cb3, d3a5cb4, d3a5cc1, d3a5cc2, d3a5cc3, d3a5cc4, d3a5cd1, d3a5cd3, d3a5ce1, d3a5ce3, d3a5cf1, d3a5cf3, d3a5cg_, d3a5ch_, d3a5ci1, d3a5ci2, d3a5ci3, d3a5ci4, d3a5cj1, d3a5cj2, d3a5cj3, d3a5cj4, d3a5ck1, d3a5ck2, d3a5ck3, d3a5ck4, d3a5cl1, d3a5cl3, d3a5cm1, d3a5cm3, d3a5cn1, d3a5cn3, d3a5co_, d3a5cp_ complexed with adp |
PDB Entry: 3a5c (more details), 4.51 Å
SCOPe Domain Sequences for d3a5cm2:
Sequence, based on SEQRES records: (download)
>d3a5cm2 c.37.1.11 (M:79-361) V1 ATP synthase B subunit, central domain {Thermus thermophilus HB8 [TaxId: 300852]} varlgvskemlgrrfngigkpidglppitpekrlpitglplnpvarrkpeqfiqtgisti dvmntlvrgqklpifsgsglpaneiaaqiarqatvrpdlsgegekeepfavvfaamgitq relsyfiqefertgalsrsvlflnkaddptieriltprmaltvaeylafehdyhvlvilt dmtnycealreigaareeipgrrgypgymytdlatiyeragvvegkkgsvtqipilsmpd ddrthpipdltgyitegqiqlsrelhrkgiyppidplpslsrl
>d3a5cm2 c.37.1.11 (M:79-361) V1 ATP synthase B subunit, central domain {Thermus thermophilus HB8 [TaxId: 300852]} varlgvskemlgrrfngigkpidglppitpekrlpitglplnpvarrkpeqfiqtgisti dvmntlvrgqklpifsgsglpaneiaaqiarqatvrpkeepfavvfaamgitqrelsyfi qefertgalsrsvlflnkaddptieriltprmaltvaeylafehdyhvlviltdmtnyce alreigaareeipgrrgypgymytdlatiyeragvvegkkgsvtqipilsmpdddrthpi pdltgyitegqiqlsrelhrkgiyppidplpslsrl
Timeline for d3a5cm2:
![]() Domains from other chains: (mouse over for more information) d3a5ca1, d3a5ca2, d3a5ca3, d3a5ca4, d3a5cb1, d3a5cb2, d3a5cb3, d3a5cb4, d3a5cc1, d3a5cc2, d3a5cc3, d3a5cc4, d3a5cd1, d3a5cd2, d3a5cd3, d3a5ce1, d3a5ce2, d3a5ce3, d3a5cf1, d3a5cf2, d3a5cf3, d3a5cg_, d3a5ch_, d3a5ci1, d3a5ci2, d3a5ci3, d3a5ci4, d3a5cj1, d3a5cj2, d3a5cj3, d3a5cj4, d3a5ck1, d3a5ck2, d3a5ck3, d3a5ck4, d3a5cl1, d3a5cl2, d3a5cl3, d3a5cn1, d3a5cn2, d3a5cn3, d3a5co_, d3a5cp_ |