SCOPe 2.06: Domain d3a5cp_: 3a5c P:

Lineage for d3a5cp_ (3a5c P:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.149: AtpF-like [159467] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.149.1: AtpF-like [159468] (1 family)
   automatically mapped to Pfam PF01990

5. Family c.149.1.1: AtpF-like [159469] (2 proteins)
   Pfam PF01990; segment-swapping in some members

6. Protein V-type ATP synthase subunit F, AtpF [159470] (4 species)

7. Species Thermus thermophilus HB8 [TaxId:300852] [310957] (1 PDB entry)

8. Domain d3a5cp_: 3a5c P: [304913]
   Other proteins in same PDB: d3a5ca1, d3a5ca2, d3a5ca3, d3a5ca4, d3a5cb1, d3a5cb2, d3a5cb3, d3a5cb4, d3a5cc1, d3a5cc2, d3a5cc3, d3a5cc4, d3a5cd1, d3a5cd2, d3a5cd3, d3a5ce1, d3a5ce2, d3a5ce3, d3a5cf1, d3a5cf2, d3a5cf3, d3a5cg_, d3a5ci1, d3a5ci2, d3a5ci3, d3a5ci4, d3a5cj1, d3a5cj2, d3a5cj3, d3a5cj4, d3a5ck1, d3a5ck2, d3a5ck3, d3a5ck4, d3a5cl1, d3a5cl2, d3a5cl3, d3a5cm1, d3a5cm2, d3a5cm3, d3a5cn1, d3a5cn2, d3a5cn3, d3a5co_
   complexed with adp

Details for d3a5cp_

PDB Entry: 3a5c, 4.51 Å

PDB Description: Inter-subunit interaction and quaternary rearrangement defined by the central stalk of prokaryotic V1-ATPase

PDB Compounds: (P:) V-type ATP synthase subunit F

SCOPe Domain Sequences for d3a5cp_:

Sequence; same for both SEQRES and ATOM records:

>d3a5cp_ c.149.1.1 (P:) V-type ATP synthase subunit F, AtpF {Thermus thermophilus HB8 [TaxId: 300852]}
maviadpetaqgfrlaglegygassaeeaqslletlverggyalvavdeallpdperave
rlmrgrdlpvllpiaglkeafqghdvegymrelvrktigfdikl

Timeline for d3a5cp_:

• d3a5cp_ is new in SCOPe 2.06-stable
  
• d3a5cp_ appears in SCOPe 2.07
  
• d3a5cp_ appears in the current release, SCOPe 2.08