![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
![]() | Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
![]() | Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
![]() | Protein Snake coagglutinin beta chain [88867] (10 species) heterodimeric coagulation factors IX/X-binding protein (IX/X-BP) |
![]() | Species Puff adder (Bitis arietans), bitiscetin [TaxId:8692] [88872] (2 PDB entries) |
![]() | Domain d1uexb_: 1uex B: [99283] Other proteins in same PDB: d1uexa_, d1uexc_ complexed with the von Willebrand factor a1 domain |
PDB Entry: 1uex (more details), 2.85 Å
SCOPe Domain Sequences for d1uexb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uexb_ d.169.1.1 (B:) Snake coagglutinin beta chain {Puff adder (Bitis arietans), bitiscetin [TaxId: 8692]} gclpdwssykghcykvfkvektwadaekfckelvngghlmsvnsreegefisklalekmr ivlvwiglshfwricplrwtdgarldyralsdepicfvaesfhnkwiqwtcnrkksfvck yrv
Timeline for d1uexb_: