SCOPe 2.05: Domain d1uexb_: 1uex B:

Lineage for d1uexb_ (1uex B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein Snake coagglutinin beta chain [88867] (10 species)
   heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)

7. Species Puff adder (Bitis arietans), bitiscetin [TaxId:8692] [88872] (2 PDB entries)

8. Domain d1uexb_: 1uex B: [99283]
   Other proteins in same PDB: d1uexa_, d1uexc_
   complexed with the von Willebrand factor a1 domain

Details for d1uexb_

PDB Entry: 1uex, 2.85 Å

PDB Description: Crystal structure of von Willebrand Factor A1 domain complexed with snake venom bitiscetin

PDB Compounds: (B:) bitiscetin beta chain

SCOPe Domain Sequences for d1uexb_:

Sequence; same for both SEQRES and ATOM records:

>d1uexb_ d.169.1.1 (B:) Snake coagglutinin beta chain {Puff adder (Bitis arietans), bitiscetin [TaxId: 8692]}
gclpdwssykghcykvfkvektwadaekfckelvngghlmsvnsreegefisklalekmr
ivlvwiglshfwricplrwtdgarldyralsdepicfvaesfhnkwiqwtcnrkksfvck
yrv

Timeline for d1uexb_:

• d1uexb_ first appeared in SCOP 1.67
  
• d1uexb_ appears in SCOPe 2.04
  
• d1uexb_ appears in SCOPe 2.06
  
• d1uexb_ appears in the current release, SCOPe 2.08