Lineage for d1uexb_ (1uex B:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 421327Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 421328Superfamily d.169.1: C-type lectin-like [56436] (6 families) (S)
  5. 421329Family d.169.1.1: C-type lectin domain [56437] (22 proteins)
  6. 421569Protein Snake coagglutinin beta chain [88867] (9 species)
    heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)
  7. 421583Species Puff adder (Bitis arientans), bitiscetin [88872] (2 PDB entries)
  8. 421585Domain d1uexb_: 1uex B: [99283]
    Other proteins in same PDB: d1uexa_, d1uexc_
    complexed with the von Willebrand factor a1 domain

Details for d1uexb_

PDB Entry: 1uex (more details), 2.85 Å

PDB Description: Crystal structure of von Willebrand Factor A1 domain complexed with snake venom bitiscetin

SCOP Domain Sequences for d1uexb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uexb_ d.169.1.1 (B:) Snake coagglutinin beta chain {Puff adder (Bitis arientans), bitiscetin}
gclpdwssykghcykvfkvektwadaekfckelvngghlmsvnsreegefisklalekmr
ivlvwiglshfwricplrwtdgarldyralsdepicfvaesfhnkwiqwtcnrkksfvck
yrv

SCOP Domain Coordinates for d1uexb_:

Click to download the PDB-style file with coordinates for d1uexb_.
(The format of our PDB-style files is described here.)

Timeline for d1uexb_: