Lineage for d1uexa_ (1uex A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 421327Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 421328Superfamily d.169.1: C-type lectin-like [56436] (6 families) (S)
  5. 421329Family d.169.1.1: C-type lectin domain [56437] (22 proteins)
  6. 421539Protein Snake coagglutinin alpha chain [88861] (9 species)
    heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)
  7. 421553Species Puff adder (Bitis arientans), bitiscetin [88866] (2 PDB entries)
  8. 421555Domain d1uexa_: 1uex A: [99282]
    Other proteins in same PDB: d1uexb_, d1uexc_
    complexed with the von Willebrand factor a1 domain

Details for d1uexa_

PDB Entry: 1uex (more details), 2.85 Å

PDB Description: Crystal structure of von Willebrand Factor A1 domain complexed with snake venom bitiscetin

SCOP Domain Sequences for d1uexa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uexa_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Puff adder (Bitis arientans), bitiscetin}
gclpdwssykghcykvfkkvgtwedaekfcvensghlasidskeeadfvtklasqtltkf
vydawiglrdesktqqcspqwtdgssvvyenvdeptkcfgldvhteyrtwtdlpcgeknp
ficks

SCOP Domain Coordinates for d1uexa_:

Click to download the PDB-style file with coordinates for d1uexa_.
(The format of our PDB-style files is described here.)

Timeline for d1uexa_: