Lineage for d1uexb_ (1uex B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3001355Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 3001710Protein Snake coagglutinin beta chain [88867] (10 species)
    heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)
  7. 3001731Species Puff adder (Bitis arietans), bitiscetin [TaxId:8692] [88872] (2 PDB entries)
  8. 3001733Domain d1uexb_: 1uex B: [99283]
    Other proteins in same PDB: d1uexa_, d1uexc_
    complexed with the von Willebrand factor a1 domain

Details for d1uexb_

PDB Entry: 1uex (more details), 2.85 Å

PDB Description: Crystal structure of von Willebrand Factor A1 domain complexed with snake venom bitiscetin
PDB Compounds: (B:) bitiscetin beta chain

SCOPe Domain Sequences for d1uexb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uexb_ d.169.1.1 (B:) Snake coagglutinin beta chain {Puff adder (Bitis arietans), bitiscetin [TaxId: 8692]}
gclpdwssykghcykvfkvektwadaekfckelvngghlmsvnsreegefisklalekmr
ivlvwiglshfwricplrwtdgarldyralsdepicfvaesfhnkwiqwtcnrkksfvck
yrv

SCOPe Domain Coordinates for d1uexb_:

Click to download the PDB-style file with coordinates for d1uexb_.
(The format of our PDB-style files is described here.)

Timeline for d1uexb_: