PDB entry 1uex

View 1uex on RCSB PDB site
Description: Crystal structure of von Willebrand Factor A1 domain complexed with snake venom bitiscetin
Class: toxin/blood clotting
Keywords: C-type lectin heterodimer, TOXIN/BLOOD CLOTTING COMPLEX
Deposited on 2003-05-22, released 2003-09-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.194
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bitiscetin alpha chain
    Species: Bitis arietans [TaxId:8692]
    Database cross-references and differences (RAF-indexed):
    • GB JC5058
    Domains in SCOPe 2.06: d1uexa_
  • Chain 'B':
    Compound: bitiscetin beta chain
    Species: Bitis arietans [TaxId:8692]
    Database cross-references and differences (RAF-indexed):
    • GB JC5059 (Start-124)
    Domains in SCOPe 2.06: d1uexb_
  • Chain 'C':
    Compound: von willebrand factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1uexc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uexA (A:)
    dpgclpdwssykghcykvfkkvgtwedaekfcvensghlasidskeeadfvtklasqtlt
    kfvydawiglrdesktqqcspqwtdgssvvyenvdeptkcfgldvhteyrtwtdlpcgek
    npficksrlph
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uexA (A:)
    gclpdwssykghcykvfkkvgtwedaekfcvensghlasidskeeadfvtklasqtltkf
    vydawiglrdesktqqcspqwtdgssvvyenvdeptkcfgldvhteyrtwtdlpcgeknp
    ficks
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uexB (B:)
    degclpdwssykghcykvfkvektwadaekfckelvngghlmsvnsreegefisklalek
    mrivlvwiglshfwricplrwtdgarldyralsdepicfvaesfhnkwiqwtcnrkksfv
    ckyrv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uexB (B:)
    gclpdwssykghcykvfkvektwadaekfckelvngghlmsvnsreegefisklalekmr
    ivlvwiglshfwricplrwtdgarldyralsdepicfvaesfhnkwiqwtcnrkksfvck
    yrv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1uexC (C:)
    edisepplhdfycsrlldlvflldgssrlseaefevlkafvvdmmerlrisqkwvrvavv
    eyhdgshayiglkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasr
    ialllmasqepqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafv
    lssvdeleqqrdeivsylcdlapeapppt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uexC (C:)
    epplhdfycsrlldlvflldgssrlseaefevlkafvvdmmerlrisqkwvrvavveyhd
    gshayiglkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasriall
    lmasqepqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvlssv
    deleqqrdeivsylcdlapeap