Lineage for d1pzul1 (1pzu L:576-678)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765064Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins)
    subgroup of the larger IPT/TIG domain family
  6. 2765141Protein T-cell transcription factor NFAT1 (NFATC2) [49246] (1 species)
  7. 2765142Species Human (Homo sapiens) [TaxId:9606] [49247] (7 PDB entries)
  8. 2765162Domain d1pzul1: 1pzu L:576-678 [95479]
    Other proteins in same PDB: d1pzub2, d1pzud2, d1pzuh2, d1pzui2, d1pzul2, d1pzum2
    protein/DNA complex

Details for d1pzul1

PDB Entry: 1pzu (more details), 3.1 Å

PDB Description: An asymmetric NFAT1-RHR homodimer on a pseudo-palindromic, Kappa-B site
PDB Compounds: (L:) Nuclear factor of activated T-cells, cytoplasmic 2

SCOPe Domain Sequences for d1pzul1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pzul1 b.1.18.1 (L:576-678) T-cell transcription factor NFAT1 (NFATC2) {Human (Homo sapiens) [TaxId: 9606]}
elpmverqdtdsclvyggqqmiltgqnftseskvvftekttdgqqiwemeatvdkdksqp
nmlfveipeyrnkhirtpvkvnfyvingkrkrsqpqhftyhpv

SCOPe Domain Coordinates for d1pzul1:

Click to download the PDB-style file with coordinates for d1pzul1.
(The format of our PDB-style files is described here.)

Timeline for d1pzul1: