Class b: All beta proteins [48724] (180 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.5: p53-like transcription factors [49417] (8 families) |
Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (7 proteins) automatically mapped to Pfam PF00554 |
Protein T-cell transcription factor NFAT1 (NFATC), DNA-binding domain [49421] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49422] (9 PDB entries) |
Domain d1pzuh2: 1pzu H:399-571 [95476] Other proteins in same PDB: d1pzub1, d1pzud1, d1pzuh1, d1pzui1, d1pzul1, d1pzum1 protein/DNA complex |
PDB Entry: 1pzu (more details), 3.1 Å
SCOPe Domain Sequences for d1pzuh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pzuh2 b.2.5.3 (H:399-571) T-cell transcription factor NFAT1 (NFATC), DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} wplssqsgsyelrievqpkphhrahyetegsrgavkaptgghpvvqlhgymenkplglqi figtaderilkphafyqvhritgktvtttsyekivgntkvleiplepknnmratidcagi lklrnadielrkgetdigrkntrvrlvfrvhipessgrivslqtasnpiecsq
Timeline for d1pzuh2: