Lineage for d1pzub2 (1pzu B:399-571)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2767925Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2768236Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (7 proteins)
    automatically mapped to Pfam PF00554
  6. 2768281Protein T-cell transcription factor NFAT1 (NFATC), DNA-binding domain [49421] (1 species)
  7. 2768282Species Human (Homo sapiens) [TaxId:9606] [49422] (9 PDB entries)
  8. 2768298Domain d1pzub2: 1pzu B:399-571 [95472]
    Other proteins in same PDB: d1pzub1, d1pzud1, d1pzuh1, d1pzui1, d1pzul1, d1pzum1
    protein/DNA complex

Details for d1pzub2

PDB Entry: 1pzu (more details), 3.1 Å

PDB Description: An asymmetric NFAT1-RHR homodimer on a pseudo-palindromic, Kappa-B site
PDB Compounds: (B:) Nuclear factor of activated T-cells, cytoplasmic 2

SCOPe Domain Sequences for d1pzub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pzub2 b.2.5.3 (B:399-571) T-cell transcription factor NFAT1 (NFATC), DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
wplssqsgsyelrievqpkphhrahyetegsrgavkaptgghpvvqlhgymenkplglqi
figtaderilkphafyqvhritgktvtttsyekivgntkvleiplepknnmratidcagi
lklrnadielrkgetdigrkntrvrlvfrvhipessgrivslqtasnpiecsq

SCOPe Domain Coordinates for d1pzub2:

Click to download the PDB-style file with coordinates for d1pzub2.
(The format of our PDB-style files is described here.)

Timeline for d1pzub2: