PDB entry 1pzu

View 1pzu on RCSB PDB site
Description: An asymmetric NFAT1-RHR homodimer on a pseudo-palindromic, Kappa-B site
Class: transcription/DNA
Keywords: TRANSCRIPTION FACTOR, NFAT1-RHR homodimer, PROTEIN-DNA COMPLEX, human IL8 promoter, TRANSCRIPTION/DNA COMPLEX
Deposited on 2003-07-14, released 2003-09-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.296
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Nuclear factor of activated T-cells, cytoplasmic 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NFAT1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1pzub1, d1pzub2
  • Chain 'D':
    Compound: Nuclear factor of activated T-cells, cytoplasmic 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NFAT1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1pzud1, d1pzud2
  • Chain 'H':
    Compound: Nuclear factor of activated T-cells, cytoplasmic 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NFAT1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1pzuh1, d1pzuh2
  • Chain 'I':
    Compound: Nuclear factor of activated T-cells, cytoplasmic 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NFAT1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1pzui1, d1pzui2
  • Chain 'L':
    Compound: Nuclear factor of activated T-cells, cytoplasmic 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NFAT1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1pzul1, d1pzul2
  • Chain 'M':
    Compound: Nuclear factor of activated T-cells, cytoplasmic 2
    Species: Homo sapiens [TaxId:9606]
    Gene: NFAT1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1pzum1, d1pzum2
  • Chain 'T':
    Compound: 5'-d(*tp*tp*gp*ap*gp*gp*ap*ap*tp*tp*tp*cp*cp*a)-3'
  • Chain 'V':
    Compound: 5'-d(*tp*tp*gp*ap*gp*gp*ap*ap*tp*tp*tp*cp*cp*a)-3'
  • Chain 'W':
    Compound: 5'-d(*ap*ap*tp*gp*gp*ap*ap*ap*tp*tp*cp*cp*tp*c)-3'
  • Chain 'X':
    Compound: 5'-d(*tp*tp*gp*ap*gp*gp*ap*ap*tp*tp*tp*cp*cp*a)-3'
  • Chain 'Y':
    Compound: 5'-d(*ap*ap*tp*gp*gp*ap*ap*ap*tp*tp*cp*cp*tp*c)-3'
  • Chain 'Z':
    Compound: 5'-d(*ap*ap*tp*gp*gp*ap*ap*ap*tp*tp*cp*cp*tp*c)-3'

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pzuB (B:)
    mrgshhhhhhtdphassvplewplssqsgsyelrievqpkphhrahyetegsrgavkapt
    gghpvvqlhgymenkplglqifigtaderilkphafyqvhritgktvtttsyekivgntk
    vleiplepknnmratidcagilklrnadielrkgetdigrkntrvrlvfrvhipessgri
    vslqtasnpiecsqrsahelpmverqdtdsclvyggqqmiltgqnftseskvvftekttd
    gqqiwemeatvdkdksqpnmlfveipeyrnkhirtpvkvnfyvingkrkrsqpqhftyhp
    v
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pzuB (B:)
    wplssqsgsyelrievqpkphhrahyetegsrgavkaptgghpvvqlhgymenkplglqi
    figtaderilkphafyqvhritgktvtttsyekivgntkvleiplepknnmratidcagi
    lklrnadielrkgetdigrkntrvrlvfrvhipessgrivslqtasnpiecsqelpmver
    qdtdsclvyggqqmiltgqnftseskvvftekttdgqqiwemeatvdkdksqpnmlfvei
    peyrnkhirtpvkvnfyvingkrkrsqpqhftyhpv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1pzuD (D:)
    mrgshhhhhhtdphassvplewplssqsgsyelrievqpkphhrahyetegsrgavkapt
    gghpvvqlhgymenkplglqifigtaderilkphafyqvhritgktvtttsyekivgntk
    vleiplepknnmratidcagilklrnadielrkgetdigrkntrvrlvfrvhipessgri
    vslqtasnpiecsqrsahelpmverqdtdsclvyggqqmiltgqnftseskvvftekttd
    gqqiwemeatvdkdksqpnmlfveipeyrnkhirtpvkvnfyvingkrkrsqpqhftyhp
    v
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pzuD (D:)
    wplssqsgsyelrievqpkphhrahyetegsrgavkaptgghpvvqlhgymenkplglqi
    figtaderilkphafyqvhritgktvtttsyekivgntkvleiplepknnmratidcagi
    lklrnadielrkgetdigrkntrvrlvfrvhipessgrivslqtasnpiecsqelpmver
    qdtdsclvyggqqmiltgqnftseskvvftekttdgqqiwemeatvdkdksqpnmlfvei
    peyrnkhirtpvkvnfyvingkrkrsqpqhftyhpv
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1pzuH (H:)
    mrgshhhhhhtdphassvplewplssqsgsyelrievqpkphhrahyetegsrgavkapt
    gghpvvqlhgymenkplglqifigtaderilkphafyqvhritgktvtttsyekivgntk
    vleiplepknnmratidcagilklrnadielrkgetdigrkntrvrlvfrvhipessgri
    vslqtasnpiecsqrsahelpmverqdtdsclvyggqqmiltgqnftseskvvftekttd
    gqqiwemeatvdkdksqpnmlfveipeyrnkhirtpvkvnfyvingkrkrsqpqhftyhp
    v
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pzuH (H:)
    wplssqsgsyelrievqpkphhrahyetegsrgavkaptgghpvvqlhgymenkplglqi
    figtaderilkphafyqvhritgktvtttsyekivgntkvleiplepknnmratidcagi
    lklrnadielrkgetdigrkntrvrlvfrvhipessgrivslqtasnpiecsqelpmver
    qdtdsclvyggqqmiltgqnftseskvvftekttdgqqiwemeatvdkdksqpnmlfvei
    peyrnkhirtpvkvnfyvingkrkrsqpqhftyhpv
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1pzuI (I:)
    mrgshhhhhhtdphassvplewplssqsgsyelrievqpkphhrahyetegsrgavkapt
    gghpvvqlhgymenkplglqifigtaderilkphafyqvhritgktvtttsyekivgntk
    vleiplepknnmratidcagilklrnadielrkgetdigrkntrvrlvfrvhipessgri
    vslqtasnpiecsqrsahelpmverqdtdsclvyggqqmiltgqnftseskvvftekttd
    gqqiwemeatvdkdksqpnmlfveipeyrnkhirtpvkvnfyvingkrkrsqpqhftyhp
    v
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pzuI (I:)
    wplssqsgsyelrievqpkphhrahyetegsrgavkaptgghpvvqlhgymenkplglqi
    figtaderilkphafyqvhritgktvtttsyekivgntkvleiplepknnmratidcagi
    lklrnadielrkgetdigrkntrvrlvfrvhipessgrivslqtasnpiecsqelpmver
    qdtdsclvyggqqmiltgqnftseskvvftekttdgqqiwemeatvdkdksqpnmlfvei
    peyrnkhirtpvkvnfyvingkrkrsqpqhftyhpv
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1pzuL (L:)
    mrgshhhhhhtdphassvplewplssqsgsyelrievqpkphhrahyetegsrgavkapt
    gghpvvqlhgymenkplglqifigtaderilkphafyqvhritgktvtttsyekivgntk
    vleiplepknnmratidcagilklrnadielrkgetdigrkntrvrlvfrvhipessgri
    vslqtasnpiecsqrsahelpmverqdtdsclvyggqqmiltgqnftseskvvftekttd
    gqqiwemeatvdkdksqpnmlfveipeyrnkhirtpvkvnfyvingkrkrsqpqhftyhp
    v
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pzuL (L:)
    wplssqsgsyelrievqpkphhrahyetegsrgavkaptgghpvvqlhgymenkplglqi
    figtaderilkphafyqvhritgktvtttsyekivgntkvleiplepknnmratidcagi
    lklrnadielrkgetdigrkntrvrlvfrvhipessgrivslqtasnpiecsqelpmver
    qdtdsclvyggqqmiltgqnftseskvvftekttdgqqiwemeatvdkdksqpnmlfvei
    peyrnkhirtpvkvnfyvingkrkrsqpqhftyhpv
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1pzuM (M:)
    mrgshhhhhhtdphassvplewplssqsgsyelrievqpkphhrahyetegsrgavkapt
    gghpvvqlhgymenkplglqifigtaderilkphafyqvhritgktvtttsyekivgntk
    vleiplepknnmratidcagilklrnadielrkgetdigrkntrvrlvfrvhipessgri
    vslqtasnpiecsqrsahelpmverqdtdsclvyggqqmiltgqnftseskvvftekttd
    gqqiwemeatvdkdksqpnmlfveipeyrnkhirtpvkvnfyvingkrkrsqpqhftyhp
    v
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pzuM (M:)
    wplssqsgsyelrievqpkphhrahyetegsrgavkaptgghpvvqlhgymenkplglqi
    figtaderilkphafyqvhritgktvtttsyekivgntkvleiplepknnmratidcagi
    lklrnadielrkgetdigrkntrvrlvfrvhipessgrivslqtasnpiecsqelpmver
    qdtdsclvyggqqmiltgqnftseskvvftekttdgqqiwemeatvdkdksqpnmlfvei
    peyrnkhirtpvkvnfyvingkrkrsqpqhftyhpv
    

  • Chain 'T':
    No sequence available.

  • Chain 'V':
    No sequence available.

  • Chain 'W':
    No sequence available.

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    No sequence available.

  • Chain 'Z':
    No sequence available.