SCOPe 2.07: Domain d1pzul1: 1pzu L:576-678

Lineage for d1pzul1 (1pzu L:576-678)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins)
   subgroup of the larger IPT/TIG domain family

6. Protein T-cell transcription factor NFAT1 (NFATC2) [49246] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49247] (7 PDB entries)

8. Domain d1pzul1: 1pzu L:576-678 [95479]
   Other proteins in same PDB: d1pzub2, d1pzud2, d1pzuh2, d1pzui2, d1pzul2, d1pzum2
   protein/DNA complex

Details for d1pzul1

PDB Entry: 1pzu, 3.1 Å

PDB Description: An asymmetric NFAT1-RHR homodimer on a pseudo-palindromic, Kappa-B site

PDB Compounds: (L:) Nuclear factor of activated T-cells, cytoplasmic 2

SCOPe Domain Sequences for d1pzul1:

Sequence; same for both SEQRES and ATOM records:

>d1pzul1 b.1.18.1 (L:576-678) T-cell transcription factor NFAT1 (NFATC2) {Human (Homo sapiens) [TaxId: 9606]}
elpmverqdtdsclvyggqqmiltgqnftseskvvftekttdgqqiwemeatvdkdksqp
nmlfveipeyrnkhirtpvkvnfyvingkrkrsqpqhftyhpv

Timeline for d1pzul1:

• d1pzul1 first appeared in SCOP 1.67
  
• d1pzul1 appears in SCOPe 2.06
  
• d1pzul1 appears in the current release, SCOPe 2.08