![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins) duplication: tandem repeat of two RecA-like (AAA) domains |
![]() | Protein RecQ helicase domain [102385] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [102386] (2 PDB entries) |
![]() | Domain d1oywa2: 1oyw A:1-206 [93761] Other proteins in same PDB: d1oywa1 complexed with mn, zn has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1oyw (more details), 1.8 Å
SCOPe Domain Sequences for d1oywa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} maqaevlnlesgakqvlqetfgyqqfrpgqeeiidtvlsgrdclvvmptgggkslcyqip alllngltvvvsplislmkdqvdqlqangvaaaclnstqtreqqlevmtgcrtgqirlly iaperlmldnflehlahwnpvllavdeahcisqwghdfrpeyaalgqlrqrfptlpfmal tataddttrqdivrllglndpliqis
Timeline for d1oywa2: