PDB entry 1oyw

View 1oyw on RCSB PDB site
Description: Structure of the RecQ Catalytic Core
Class: hydrolase
Keywords: RecQ, helicase, Winged helix, Helix-turn-helix, ATP binding, Zn(2+) binding, HYDROLASE
Deposited on 2003-04-07, released 2003-10-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.213
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent DNA helicase
    Species: Escherichia coli [TaxId:562]
    Gene: recQ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15043 (1-End)
      • initiating met (0)
      • cloning artifact (46)
      • cloning artifact (77)
      • cloning artifact (107)
      • cloning artifact (126)
      • cloning artifact (177)
      • cloning artifact (215)
      • cloning artifact (217)
      • cloning artifact (227)
      • cloning artifact (297)
      • cloning artifact (336)
      • cloning artifact (344)
      • cloning artifact (370)
      • cloning artifact (431)
      • cloning artifact (459)
    Domains in SCOPe 2.07: d1oywa1, d1oywa2, d1oywa3
  • Heterogens: ZN, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1oywA (A:)
    maqaevlnlesgakqvlqetfgyqqfrpgqeeiidtvlsgrdclvvmptgggkslcyqip
    alllngltvvvsplislmkdqvdqlqangvaaaclnstqtreqqlevmtgcrtgqirlly
    iaperlmldnflehlahwnpvllavdeahcisqwghdfrpeyaalgqlrqrfptlpfmal
    tataddttrqdivrllglndpliqissfdrpnirymlmekfkpldqlmryvqeqrgksgi
    iycnsrakvedtaarlqskgisaaayhaglennvradvqekfqrddlqivvatvafgmgi
    nkpnvrfvvhfdiprniesyyqetgragrdglpaeamlfydpadmawlrrcleekpqgql
    qdierhklnamgafaeaqtcrrlvllnyfgegrqepcgncdicldppkqydgstdaqial
    stigrvnqrfgmgyvvevirgannqrirdyghdklkvygmgrdkshehwvsvirqlihlg
    lvtqniaqhsalqlteaarpvlrgesslqlavprivalkpkam
    

    Sequence, based on observed residues (ATOM records): (download)
    >1oywA (A:)
    maqaevlnlesgakqvlqetfgyqqfrpgqeeiidtvlsgrdclvvmptgggkslcyqip
    alllngltvvvsplislmkdqvdqlqangvaaaclnstqtreqqlevmtgcrtgqirlly
    iaperlmldnflehlahwnpvllavdeahcisqwghdfrpeyaalgqlrqrfptlpfmal
    tataddttrqdivrllglndpliqissfdrpnirymlmekfkpldqlmryvqeqrgksgi
    iycnsrakvedtaarlqskgisaaayhaglennvradvqekfqrddlqivvatvafgmgi
    nkpnvrfvvhfdiprniesyyqetgragrdglpaeamlfydpadmawlrrcleekpqgql
    qdierhklnamgafaeaqtcrrlvllnyfgegrqepcgncdicldppkqydgstdaqial
    stigrvnqrfgmgyvvevirgannqrirdyghdklkvygmgrdkshehwvsvirqlihlg
    lvtqniaqhsalqlteaarpvlrgesslqlavpriv