Lineage for d1oywa1 (1oyw A:407-516)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694109Family a.4.5.43: RecQ helicase DNA-binding domain-like [101030] (3 proteins)
    follows the tandem AAA-ATPase domain
  6. 2694110Protein DNA helicase RecQ DNA-binding domain [101031] (1 species)
  7. 2694111Species Escherichia coli [TaxId:562] [101032] (2 PDB entries)
  8. 2694112Domain d1oywa1: 1oyw A:407-516 [93760]
    Other proteins in same PDB: d1oywa2, d1oywa3
    complexed with mn, zn

Details for d1oywa1

PDB Entry: 1oyw (more details), 1.8 Å

PDB Description: structure of the recq catalytic core
PDB Compounds: (A:) ATP-dependent DNA helicase

SCOPe Domain Sequences for d1oywa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oywa1 a.4.5.43 (A:407-516) DNA helicase RecQ DNA-binding domain {Escherichia coli [TaxId: 562]}
pkqydgstdaqialstigrvnqrfgmgyvvevirgannqrirdyghdklkvygmgrdksh
ehwvsvirqlihlglvtqniaqhsalqlteaarpvlrgesslqlavpriv

SCOPe Domain Coordinates for d1oywa1:

Click to download the PDB-style file with coordinates for d1oywa1.
(The format of our PDB-style files is described here.)

Timeline for d1oywa1: