Lineage for d1oywa3 (1oyw A:207-406)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870646Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 2870860Protein RecQ helicase domain [102385] (1 species)
  7. 2870861Species Escherichia coli [TaxId:562] [102386] (2 PDB entries)
  8. 2870863Domain d1oywa3: 1oyw A:207-406 [93762]
    Other proteins in same PDB: d1oywa1
    complexed with mn, zn
    has additional insertions and/or extensions that are not grouped together

Details for d1oywa3

PDB Entry: 1oyw (more details), 1.8 Å

PDB Description: structure of the recq catalytic core
PDB Compounds: (A:) ATP-dependent DNA helicase

SCOPe Domain Sequences for d1oywa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]}
sfdrpnirymlmekfkpldqlmryvqeqrgksgiiycnsrakvedtaarlqskgisaaay
haglennvradvqekfqrddlqivvatvafgmginkpnvrfvvhfdiprniesyyqetgr
agrdglpaeamlfydpadmawlrrcleekpqgqlqdierhklnamgafaeaqtcrrlvll
nyfgegrqepcgncdicldp

SCOPe Domain Coordinates for d1oywa3:

Click to download the PDB-style file with coordinates for d1oywa3.
(The format of our PDB-style files is described here.)

Timeline for d1oywa3: