![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.40: N-terminal domain of Bacillus PurR [101021] (1 protein) automatically mapped to Pfam PF09182 |
![]() | Protein N-terminal domain of Bacillus PurR [101022] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [101023] (3 PDB entries) |
![]() | Domain d1o57c1: 1o57 C:1-74 [92487] Other proteins in same PDB: d1o57a2, d1o57b2, d1o57c2, d1o57d2 complexed with 1pe, 2pe, epe, p6g, pg4, so4 |
PDB Entry: 1o57 (more details), 2.2 Å
SCOPe Domain Sequences for d1o57c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o57c1 a.4.5.40 (C:1-74) N-terminal domain of Bacillus PurR {Bacillus subtilis [TaxId: 1423]} mkfrrsgrlvdltnyllthphelipltffseryesakssisedltiikqtfeqqgigtll tvpgaaggvkyipk
Timeline for d1o57c1: