Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (3 families) |
Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins) |
Protein Pur operon repressor (PurR), C-terminal domain [102539] (1 species) |
Species Bacillus subtilis [TaxId:1423] [102540] (3 PDB entries) |
Domain d1o57a2: 1o57 A:75-276 [92484] Other proteins in same PDB: d1o57a1, d1o57b1, d1o57c1, d1o57d1 complexed with 1pe, 2pe, epe, p6g, pg4, so4 |
PDB Entry: 1o57 (more details), 2.2 Å
SCOPe Domain Sequences for d1o57a2:
Sequence, based on SEQRES records: (download)
>d1o57a2 c.61.1.1 (A:75-276) Pur operon repressor (PurR), C-terminal domain {Bacillus subtilis [TaxId: 1423]} mkqaeaeefvqtlgqslanperilpggyvyltdilgkpsvlskvgklfasvfaereidvv mtvatkgiplayaaasylnvpvvivrkdnkvtegstvsinyvsgssnriqtmslakrsmk tgsnvliiddfmkaggtingminlldefnanvagigvlveaegvderlvdeymslltlst inmkeksieiqngnflrffkdn
>d1o57a2 c.61.1.1 (A:75-276) Pur operon repressor (PurR), C-terminal domain {Bacillus subtilis [TaxId: 1423]} mkqaeaeefvqtlgqslanperilpggyvyltdilgkpsvlskvgklfasvfaereidvv mtvatkgiplayaaasylnvpvvivrkdgstvsinyvsgssnriqtmslakrsmktgsnv liiddfmkaggtingminlldefnanvagigvlveaegvderlvdeymslltlstinmke ksieiqngnflrffkdn
Timeline for d1o57a2: